PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G034600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 298aa    MW: 34149.2 Da    PI: 5.4251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G034600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-182370148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT eEd ll+++++ +G g+W+  a++ g++Rt+k+c++rw++yl
  Aqcoe3G034600.1.p 23 RGPWTLEEDSLLIHYIASHGEGRWDMLAKCSGLKRTGKSCRLRWLNYL 70
                       89********************************************97 PP

2Myb_DNA-binding47.83.4e-1576119146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+ T eE+  +++++ ++G++ W++Ia++++ gRt++++k++w++
  Aqcoe3G034600.1.p  76 RGNLTLEEQVMILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 119
                        7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2151874IPR017930Myb domain
SuperFamilySSF466892.24E-3020117IPR009057Homeodomain-like
SMARTSM007171.5E-152272IPR001005SANT/Myb domain
PfamPF002492.5E-152370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-212477IPR009057Homeodomain-like
CDDcd001674.01E-122570No hitNo description
SMARTSM007171.1E-1375123IPR001005SANT/Myb domain
PROSITE profilePS5129419.57975125IPR017930Myb domain
PfamPF002496.0E-1476119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2278124IPR009057Homeodomain-like
CDDcd001679.77E-1180119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSAMSTTSKE SSSYEYEDFE LRRGPWTLEE DSLLIHYIAS HGEGRWDMLA KCSGLKRTGK  60
SCRLRWLNYL KPDVRRGNLT LEEQVMILEL HSKWGNRWSR IAQHLPGRTD NEIKNYWRTR  120
VQKQARQLNI DANSAKFRDV IRCFWMPRLL QKIEENSRSS TIENIQNPPA PLVLNQLVTS  180
SQAPPTTQSS LIVGEPIRCF NHNEYDSSPD NCNSPSVSPS LPETSPYGID NLAYNPYLQS  240
CDMDGFNLDP MSAMGGFENL ISDRQLAENN WTGGEVADSL WNMDEFWQFT KLHESSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-252012524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264231.11e-120PREDICTED: transcription factor MYB108-like
TrEMBLD7SJ031e-111D7SJ03_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g03560.t011e-111(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-81myb domain protein 62